PDB entry 3r64

View 3r64 on RCSB PDB site
Description: Crystal structure of a NAD-dependent benzaldehyde dehydrogenase from Corynebacterium glutamicum
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, NAD binding site, OXIDOREDUCTASE
Deposited on 2011-03-21, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD dependent benzaldehyde dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: xylC, cg2953
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6M2H6 (Start-485)
      • expression tag (486-492)
    Domains in SCOPe 2.07: d3r64a1, d3r64a2
  • Chain 'B':
    Compound: NAD dependent benzaldehyde dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: xylC, cg2953
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r64b_
  • Chain 'C':
    Compound: NAD dependent benzaldehyde dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: xylC, cg2953
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r64c_
  • Chain 'D':
    Compound: NAD dependent benzaldehyde dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:196627]
    Gene: xylC, cg2953
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r64d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r64A (A:)
    mvvtatfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaak
    kaqaewaatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitke
    sasfpgrvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavv
    ikpasdtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpv
    grrvgelainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrv
    ivdaavhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvq
    vegpiegrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaav
    wskdidraaqfalqidsgmvhindltvndephvmfggsknsglgrfngdwaieefttdrw
    igikrsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r64A (A:)
    tfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqae
    waatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasfp
    grvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpas
    dtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrvg
    elainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaa
    vhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvqvegpi
    egrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdi
    draaqfalqidsgmvhindrfngdwaieefttdrwigikrsaenlyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r64B (B:)
    mvvtatfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaak
    kaqaewaatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitke
    sasfpgrvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavv
    ikpasdtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpv
    grrvgelainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrv
    ivdaavhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvq
    vegpiegrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaav
    wskdidraaqfalqidsgmvhindltvndephvmfggsknsglgrfngdwaieefttdrw
    igikrsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r64B (B:)
    tfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqae
    waatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasfp
    grvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpas
    dtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrvg
    elainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaa
    vhdeflekfveavkniptgdpsagtlvgpvindsqlsglkekielakkegatvqvegpie
    grlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdid
    raaqfalqidsgmvhindrfngdwaieefttdrwigikr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r64C (C:)
    mvvtatfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaak
    kaqaewaatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitke
    sasfpgrvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavv
    ikpasdtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpv
    grrvgelainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrv
    ivdaavhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvq
    vegpiegrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaav
    wskdidraaqfalqidsgmvhindltvndephvmfggsknsglgrfngdwaieefttdrw
    igikrsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r64C (C:)
    tfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqae
    waatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasfp
    grvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpas
    dtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrvg
    elaimktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaavhde
    flekfveavkniptpsaegtlvgpvindsqlsglkekielakkegatvqvegpiegrlvh
    phvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdidraaqf
    alqidsgmvhindfngdwaieefttdrwigikr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r64D (D:)
    mvvtatfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaak
    kaqaewaatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitke
    sasfpgrvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavv
    ikpasdtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpv
    grrvgelainggpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrv
    ivdaavhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvq
    vegpiegrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaav
    wskdidraaqfalqidsgmvhindltvndephvmfggsknsglgrfngdwaieefttdrw
    igikrsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r64D (D:)
    atfagidatkhliggqwvegnsdristninpyddsviaeskqasiadvdaayeaakkaqa
    ewaatpaaersaiiyraaelleehreeivewlikesgstrskanleitlagnitkesasf
    pgrvhgrispsntpgkenrvyrvakgvvgvispwnfplnlsirsvapalavgnavvikpa
    sdtpvtggviparifeeagvpagvistvagagseigdhfvthavpklisftgstpvgrrv
    gelaingpmktvalelggnapfvvladadidaaaqaaavgaflhqgqicmsinrvivdaa
    vhdeflekfveavkniptgdpsaegtlvgpvindsqlsglkekielakkegatvqvegpi
    egrlvhphvfsdvtsdmeiareeifgplisvlkaddeahaaelanasdfglsaavwskdi
    draaqfalqidsgmvhindrfngdwaieefttdrwigik