PDB entry 3r5s

View 3r5s on RCSB PDB site
Description: Crystal structure of apo-ViuP
Class: metal transport
Keywords: Iron-vibriobactin transport protein, Periplasmic transport protein, METAL TRANSPORT
Deposited on 2011-03-19, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferric vibriobactin ABC transporter, periplasmic ferric vibriobactin-binding protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: viuP, VC_0776
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RCF6 (Start-296)
      • expression tag (297-301)
    Domains in SCOPe 2.07: d3r5sa1, d3r5sa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r5sA (A:)
    qqnvwprtfqnadgsittipsqpkrilstavtvtgtllaidapviasaattqstffeqwr
    klaelrqvkklwpagsvdlesvyveqpdlivvsmigadsardqipllqaiaptilvdysd
    qtwqslaqqlglatgleeqaertihnfeqwtkqvrdvldlpkgranivsyhgpgvvnava
    kaqsahaqllqsvgvvleepdpawqagsivhrdflrihyehltqlqaettflitmtdqqa
    qaflhdpilknlpsiqrkqvyglgensfridlfsareiinsllrrfageqaqslvmpleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r5sA (A:)
    qnvwprtfqnadgsittipsqpkrilstavtvtgtllaidapviasaattqstffeqwrk
    laelrqvkklwpagsvdlesvyveqpdlivvsmigadsardqipllqaiaptilvdysdq
    twqslaqqlglatgleeqaertihnfeqwtkqvrdvldlpkgranivsyhgpgvvnavak
    aqsahaqllqsvgvvleepdpawqagsivhrdflrihyehltqlqaettflitmtdqqaq
    aflhdpilknlpsiqrkqvyglgensfridlfsareiinsllrrfageqaqslvmplehh
    h