PDB entry 3r5f

View 3r5f on RCSB PDB site
Description: Crystal structure of D-alanine-D-alnine ligase from Xanthomonas oryzae pv. oryzae with ATP
Class: ligase
Keywords: XoDdl-ATP complex, ATP-grasp domain, ligase
Deposited on 2011-03-18, released 2011-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine--D-alanine ligase 1
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2P8P8
      • engineered mutation (343)
    Domains in SCOPe 2.06: d3r5fa1, d3r5fa2
  • Heterogens: ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r5fA (A:)
    hhhhhhhssenlyfqghmrkirvglifggksaehevslqsarnildaldpqrfepvligi
    dkqgqwhvndpdsfllhaddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvf
    pivhgtlgedgslqgllrmanlpfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdr
    htaahadvdtliaqlglplfvkpanqgssvgvsqvrtadafaaalalalaydhkvlveaa
    vagreiecavlgnavphasvcgevvvhdafysyatkyisehgaeivipadidaqtqqriq
    qiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrgli
    trlielalerhtddqllrsavelh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r5fA (A:)
    kirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllhad
    dparialhrsgrgvallpgaqqqqlrpiqalaqidvvfpivhgtlgedgslqgllrmanl
    pfvgsgvlgsavamdkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvk
    panqgssvgvsqvrtadafaaalalalaydhkvlveaavagreiecavlgnavphasvcg
    evvveivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgf
    trisvypklwqasgldyrglitrlielalerhtddqllrsave