PDB entry 3r4u

View 3r4u on RCSB PDB site
Description: Cell entry of botulinum neurotoxin type C is dependent upon interaction with two ganglioside molecules
Class: hydrolase
Keywords: Botulinum Toxins, gangliosides, Hydrolase
Deposited on 2011-03-17, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18640 (6-430)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r4ua1, d3r4ua2, d3r4ua3
  • Chain 'B':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18640 (6-430)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r4ub1, d3r4ub2, d3r4ub3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r4uA (A:)
    mrgsmanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgk
    vivtqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvft
    lkqnedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltgi
    nfsktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkd
    ywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndt
    rvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqp
    mnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyasllest
    sthwgfvpvsepgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4uA (A:)
    smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
    tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
    nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
    ktitfeinkipdtsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlryn
    keyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdily
    fdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyyas
    qifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfvpv
    se
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r4uB (B:)
    mrgsmanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgk
    vivtqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvft
    lkqnedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltgi
    nfsktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkd
    ywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndt
    rvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqp
    mnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyasllest
    sthwgfvpvsepgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4uB (B:)
    smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
    tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
    nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
    ktitfeinkipdtsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlryn
    keyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdily
    fdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyyas
    qifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfvpv
    se