PDB entry 3r4d

View 3r4d on RCSB PDB site
Description: Crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor
Class: cell adhesion/viral protein
Keywords: immunoglobulin, beta-sandwich, mCEACAM1a - immunoglobulin fold MHV spike NTD - galectin-like beta-sandwich fold, mCEACAM1a - cell adhesion MHV spike NTD - mCEACAM1a binding, mCEACAM1a - itself and MHV spike NTD MHV spike NTD - mCEACAM1a, N-glycosylations, mCEACAM1a - 37, 55, 70 MHV spike NTD - 192, CELL ADHESION-VIRAL PROTEIN complex
Deposited on 2011-03-17, released 2011-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CEA-related cell adhesion molecule 1, isoform 1/2S
    Species: Mus musculus [TaxId:10090]
    Gene: Ceacam1, CEACAM1a-2S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3r4da1, d3r4da2
  • Chain 'B':
    Compound: Spike glycoprotein
    Species: Murine coronavirus [TaxId:694005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3r4db_
  • Chain 'C':
    Compound: CEA-related cell adhesion molecule 1, isoform 1/2S
    Species: Mus musculus [TaxId:10090]
    Gene: Ceacam1, CEACAM1a-2S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3r4dc1, d3r4dc2
  • Chain 'D':
    Compound: Spike glycoprotein
    Species: Murine coronavirus [TaxId:694005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3r4dd_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r4dA (A:)
    evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
    ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvhqpvtqpflqvtnt
    tvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilridpikredageyqc
    eisnpvsvrrsnsikldiifdphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4dA (A:)
    evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
    ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvhqpvtqpflqvtnt
    tvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilridpikredageyqc
    eisnpvsvrrsnsikldii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r4dB (B:)
    yigdfrciqlvnsnganvsapsistetvevsqglgtyyvldrvylnatllltgyypvdgs
    kfrnlaltgtnsvslswfqppylsqfndgifakvqnlktstpsgatayfptivigslfgy
    tsytvviepyngvimasvcqyticqlpytdckpntngnkligfwhtdvkppicvlkrnft
    lnvnadafyfhfyqhggtfyayyadkpsattflfsvyigdiltqyyvlpficnptagstf
    aprywvtplvkrqylfnfnqkgvitsavdcassytseikckthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4dB (B:)
    yigdfrciqlvnsnganvsapsistltgyypvdgskfrnlaltgtnsvslswfqppylsq
    fndgifakvqnlktstpsgatayfptivigslfgytsytvviepyngvimasvcqyticq
    lpytdckpntngnkligfwhtdvkppicvlkrnftlnvnadafyfhfyqhggtfyayyad
    kpsattflfsvyigdiltqyyvlpficnptagstfaprywvtplvkrqy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r4dC (C:)
    evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
    ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvhqpvtqpflqvtnt
    tvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilridpikredageyqc
    eisnpvsvrrsnsikldiifdphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4dC (C:)
    evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
    ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvhqpvtqpflqvtnt
    tvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilridpikredageyqc
    eisnpvsvrrsnsikldii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r4dD (D:)
    yigdfrciqlvnsnganvsapsistetvevsqglgtyyvldrvylnatllltgyypvdgs
    kfrnlaltgtnsvslswfqppylsqfndgifakvqnlktstpsgatayfptivigslfgy
    tsytvviepyngvimasvcqyticqlpytdckpntngnkligfwhtdvkppicvlkrnft
    lnvnadafyfhfyqhggtfyayyadkpsattflfsvyigdiltqyyvlpficnptagstf
    aprywvtplvkrqylfnfnqkgvitsavdcassytseikckthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4dD (D:)
    yigdfrciqlvnsnganvsapsistltgyypvdgskfrnlaltgtnsvslswfqppylsq
    fndgifakvqnlktstpsgatayfptivigslfgytsytvviepyngvimasvcqyticq
    lpytdckpntngnkligfwhtdvkppicvlkrnftlnvnadafyfhfyqhggtfyayyad
    kpsattflfsvyigdiltqyyvlpficnptagstfaprywvtplvkrqy