PDB entry 3r42

View 3r42 on RCSB PDB site
Description: Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
Class: protein transport
Keywords: endosomal sorting, ESCRT, PROTEIN TRANSPORT
Deposited on 2011-03-17, released 2011-05-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: STP22, VPS23, YCL008C, YCL8C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25604 (Start-161)
    • engineered mutation (134)
  Domains in SCOPe 2.02: d3r42a_
• Chain 'B':
  Compound: Vacuolar protein sorting-associated protein 27
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40343 (0-End)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3r42A (A:)
  gamsangkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgt
  pqlllsiygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqe
  yidsngwialpilhawdpaamnlimvvqelmsllheppqdqa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3r42A (A:)
  gkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqllls
  iygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsng
  wialpilhawdpaamnlimvvqelmsllheppqdqa
  

  
  
• Chain 'B':
  No sequence available.