PDB entry 3r42

View 3r42 on RCSB PDB site
Description: Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide
Class: protein transport
Keywords: endosomal sorting, ESCRT, PROTEIN TRANSPORT
Deposited on 2011-03-17, released 2011-05-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: STP22, VPS23, YCL008C, YCL8C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25604 (Start-161)
      • engineered mutation (134)
    Domains in SCOPe 2.01: d3r42a_
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 27
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r42A (A:)
    gamsangkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgt
    pqlllsiygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqe
    yidsngwialpilhawdpaamnlimvvqelmsllheppqdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r42A (A:)
    gkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqllls
    iygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsng
    wialpilhawdpaamnlimvvqelmsllheppqdqa
    

  • Chain 'B':
    No sequence available.