PDB entry 3r3z

View 3r3z on RCSB PDB site
Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - WT/Glycolate
Class: hydrolase
Keywords: FAcD, Defluorinase, Alpha/beta Hydrolase, HYDROLASE
Deposited on 2011-03-16, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1 (2-303)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3r3za1, d3r3za2
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3r3zb1, d3r3zb2
  • Chain 'C':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3r3zc1, d3r3zc2
  • Chain 'D':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r3zd_
  • Heterogens: GOA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3zA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3zA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r3zB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3zB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgaspldvwrkwasdvqgapiesghflpeeapdqtaealvrffsaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r3zC (C:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3zC (C:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r3zD (D:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3zD (D:)
    adlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvivad
    lpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlaldsp
    grlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkaklas
    wtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvpm
    lalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa