PDB entry 3r3y

View 3r3y on RCSB PDB site
Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - His280Asn/Fluoroacetate
Class: hydrolase
Keywords: FAcD, Defluorinase, Alpha/beta Hydrolase, HYDROLASE
Deposited on 2011-03-16, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.153
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1
      • engineered mutation (281)
    Domains in SCOPe 2.06: d3r3ya_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1
      • engineered mutation (281)
    Domains in SCOPe 2.06: d3r3yb_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3yA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3yA (A:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r3yB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3yB (B:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgtpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffs