PDB entry 3r3q

View 3r3q on RCSB PDB site
Description: Crystal structure of the yeast Vps23 UEV domain
Class: protein transport
Keywords: endosomal sorting, ESCRT-I, PROTEIN TRANSPORT
Deposited on 2011-03-16, released 2011-05-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.165
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: STP22, VPS23, YCL008C, YCL8C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25604 (Start-161)
      • engineered mutation (134)
    Domains in SCOPe 2.01: d3r3qa_
  • Heterogens: ZN, CL, IMD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3qA (A:)
    gamsangkisvpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgt
    pqlllsiygtistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqe
    yidsngwialpilhawdpaamnlimvvqelmsllheppqdqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3qA (A:)
    svpeavvnwlfkviqpiyndgrttfhdslalldnfhslrprtrvfthsdgtpqlllsiyg
    tistgedgssphsipvimwvpsmypvkppfisinlenfdmntissslpiqeyidsngwia
    lpilhawdpaamnlimvvqelmsllheppqdqa