PDB entry 3r31

View 3r31 on RCSB PDB site
Description: Crystal structure of betaine aldehyde dehydrogenase from Agrobacterium tumefaciens
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, betaine aldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2011-03-15, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: betB, Atu0829, AGR_C_1515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r31a_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: betB, Atu0829, AGR_C_1515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r31b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r31A (A:)
    mvmtiatplkaqpkashfidgdyvedntgtpfesifpatgemiaklhaatpaiveraias
    akraqkewaamspmargrilkraadimrerndalstletldtgkpiqetivadptsgada
    feffggiapsalngdyiplggdfaytkrvplgvcvgigawnypqqiacwkaapalvagna
    mvfkpsentplgalkiaeilieaglpkglfnviqgdrdtgpllvnhpdvakvsltgsvpt
    grkvaaaaaghlkhvtmelggkspmivfddadiesavggamlgnfyssgqvcsngtrvfv
    qkkakarflenlkrrteamilgdpldyathlgplvskaqqekvlsyiekgkaegatlitg
    ggipnnvagegayvqptvfadvtddmtiareeifgpvmcvldfddedevlaranatefgl
    aggvftadlarahrvvdgleagtlwintynlcpveipfggskqsgfgrensaaalehyse
    lktvyvstgkvdapyaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r31A (A:)
    plkaqpkashfidgdyvedntgtpfesifpatgemiaklhaatpaiveraiasakraqke
    waamspmargrilkraadimrerndalstletldtgkpiqetivadptsgadafeffggi
    apsalngdyiplggdfaytkrvplgvcvgigawnypqqiacwkaapalvagnamvfkpse
    ntplgalkiaeilieaglpkglfnviqgdrdtgpllvnhpdvakvsltgsvptgrkvaaa
    aaghlkhvtmelggkspmivfddadiesavggamlgnfyssgqvcsngtrvfvqkkakar
    flenlkrrteamilgdpldyathlgplvskaqqekvlsyiekgkaegatlitgggipnnv
    agegayvqptvfadvtddmtiareeifgpvmcvldfddedevlaranatefglaggvfta
    dlarahrvvdgleagtlwintynlcpveipfggskqsgfgrensaaalehyselktvyvs
    tg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r31B (B:)
    mvmtiatplkaqpkashfidgdyvedntgtpfesifpatgemiaklhaatpaiveraias
    akraqkewaamspmargrilkraadimrerndalstletldtgkpiqetivadptsgada
    feffggiapsalngdyiplggdfaytkrvplgvcvgigawnypqqiacwkaapalvagna
    mvfkpsentplgalkiaeilieaglpkglfnviqgdrdtgpllvnhpdvakvsltgsvpt
    grkvaaaaaghlkhvtmelggkspmivfddadiesavggamlgnfyssgqvcsngtrvfv
    qkkakarflenlkrrteamilgdpldyathlgplvskaqqekvlsyiekgkaegatlitg
    ggipnnvagegayvqptvfadvtddmtiareeifgpvmcvldfddedevlaranatefgl
    aggvftadlarahrvvdgleagtlwintynlcpveipfggskqsgfgrensaaalehyse
    lktvyvstgkvdapyaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r31B (B:)
    plkaqpkashfidgdyvedntgtpfesifpatgemiaklhaatpaiveraiasakraqke
    waamspmargrilkraadimrerndalstletldtgkpiqetivadptsgadafeffggi
    apsalngdyiplggdfaytkrvplgvcvgigawnypqqiacwkaapalvagnamvfkpse
    ntplgalkiaeilieaglpkglfnviqgdrdtgpllvnhpdvakvsltgsvptgrkvaaa
    aaghlkhvtmelggkspmivfddadiesavggamlgnfyssgqvcsngtrvfvqkkakar
    flenlkrrteamilgdpldyathlgplvskaqqekvlsyiekgkaegatlitgggipnnv
    agegayvqptvfadvtddmtiareeifgpvmcvldfddedevlaranatefglaggvfta
    dlarahrvvdgleagtlwintynlcpveipfggskqsgfgrensaaalehyselktvyvs
    tg