PDB entry 3r2y

View 3r2y on RCSB PDB site
Description: MK2 kinase bound to Compound 1
Class: transferase/transferase inhibitor
Keywords: Kinase domain, Phosphotransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-15, released 2011-05-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.294
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2ya_
  • Heterogens: MLI, P4O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r2yA (A:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterease
    imksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcy
    tpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqye
    fpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    kerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2yA (A:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdtereaseimksig
    eaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettdkscdmwslgvimyil
    lcgyppfymktrirmgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwim
    qstkvpqtplhtsrvlked