PDB entry 3r2m

View 3r2m on RCSB PDB site
Description: 1.8A resolution structure of Doubly Soaked FtnA from Pseudomonas aeruginosa (pH 7.5)
Class: metal binding protein
Keywords: Bacterial Ferritin, iron binding, iron storage, iron homeostasis, iron release, iron mobilization, METAL BINDING PROTEIN
Deposited on 2011-03-14, released 2011-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfr, bfrA, PA4235
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r2ma_
  • Heterogens: FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3r2mA (A:)
mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
aqladteedhaywleqqlgliarmglenylqsqi