PDB entry 3r2b

View 3r2b on RCSB PDB site
Description: MK2 kinase bound to Compound 5b
Class: transferase/transferase inhibitor
Keywords: Kinase domain with bound inhibitor, Kinase domain, Phosphotransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-14, released 2011-05-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.279
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2ba_
  • Chain 'B':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bb_
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bc_
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bd_
  • Chain 'E':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2be_
  • Chain 'F':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bf_
  • Chain 'G':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bg_
  • Chain 'H':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bh_
  • Chain 'I':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bi_
  • Chain 'J':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bj_
  • Chain 'K':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bk_
  • Chain 'L':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r2bl_
  • Heterogens: 05B

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r2bA (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bA (A:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r2bB (B:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bB (B:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r2bC (C:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bC (C:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r2bD (D:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bD (D:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3r2bE (E:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bE (E:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3r2bF (F:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bF (F:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3r2bG (G:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bG (G:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3r2bH (H:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bH (H:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3r2bI (I:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bI (I:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3r2bJ (J:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bJ (J:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3r2bK (K:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bK (K:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3r2bL (L:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcyt
    pyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyef
    pnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    erwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r2bL (L:)
    hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
    lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevlydkscd
    mwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkteptqr
    mtitefmnhpwimqstkvpqtplhtsrvlked