PDB entry 3r27

View 3r27 on RCSB PDB site
Description: Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L (HnRNP L)
Class: protein binding
Keywords: RBD Fold, Protein Binding, Nucleus
Deposited on 2011-03-14, released 2011-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein L
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPL, HNRPL, P/OKcl.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r27a_
  • Chain 'B':
    Compound: Heterogeneous nuclear ribonucleoprotein L
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRNPL, HNRPL, P/OKcl.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r27b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r27A (A:)
    mghhhhhhmenyddphktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqa
    lvefedvlgacnavnyaadnqiyiaghpafvnystsqkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r27A (A:)
    ktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqalvefedvlgacnavny
    aadnqiyiaghpafvnystsqkis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r27B (B:)
    mghhhhhhmenyddphktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqa
    lvefedvlgacnavnyaadnqiyiaghpafvnystsqkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r27B (B:)
    ktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqalvefedvlgacnavny
    aadnqiyiaghpafvnystsqkis