PDB entry 3r23

View 3r23 on RCSB PDB site
Description: Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta structure, ligase, cytosol
Deposited on 2011-03-12, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS2435, BA_2610, ddl, ddlB, GBAA_2610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81Q29 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3r23a1, d3r23a2, d3r23a3
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS2435, BA_2610, ddl, ddlB, GBAA_2610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81Q29 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3r23b1, d3r23b2, d3r23b3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r23A (A:)
    snamrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfal
    lalhgkygedgtvqgtleslgipysgsnmlssgicmdkniskkilryegietpdwieltk
    medlnfdeldklgfplvvkpnsggssvgvkivydkdelismletvfewdsevviekyikg
    eeitcsifdgkqlpiisirhaaeffdynakyddastieevielpaelkervnkaslacyk
    alkcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysklldmiietslr
    vrkeegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r23A (A:)
    amrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfalla
    lhgkygedgtvqgtleslgipysgsnmlssgicmdkniskkilryegietpdwieltkme
    dlnfdeldklgfplvvkpnsggssvgvkivydkdelismletvfewdsevviekyikgee
    itcsifdgkqlpiisirhaaeffdynakyddastieevielpaelkervnkaslacykal
    kcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysklldmiietslrvr
    keeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r23B (B:)
    snamrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfal
    lalhgkygedgtvqgtleslgipysgsnmlssgicmdkniskkilryegietpdwieltk
    medlnfdeldklgfplvvkpnsggssvgvkivydkdelismletvfewdsevviekyikg
    eeitcsifdgkqlpiisirhaaeffdynakyddastieevielpaelkervnkaslacyk
    alkcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysklldmiietslr
    vrkeegf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r23B (B:)
    amrigvimggvssekqvsimtgnemianldknkyeivpitlnekmdliekakdidfalla
    lhgkygedgtvqgtleslgipysgsnmlssgicmdkniskkilryegietpdwieltkme
    dlnfdeldklgfplvvkpnsggvkivydkdelismletvfewdsevviekyikgeeitcs
    ifdgkqlpiisirhaaeffdynakyddastieevielpaelkervnkaslacykalkcsv
    yarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysklldmiietslrvrkeeg