PDB entry 3r22

View 3r22 on RCSB PDB site
Description: Design, synthesis, and biological evaluation of pyrazolopyridine-sulfonamides as potent multiple-mitotic kinase (MMK) inhibitors (Part I)
Class: transferase/transferase inhibitor
Keywords: Kinase domain, transferase-transferase inhibitor complex
Deposited on 2011-03-11, released 2011-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.271
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r22a_
  • Heterogens: D37, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r22A (A:)
    gplgsrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrddlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r22A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhagtldylppemiegrmhdekvdlws
    lgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpml
    revlehpwitanssk