PDB entry 3r1z

View 3r1z on RCSB PDB site
Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Complex with L-Ala-L-Glu and L-Ala-D-Glu
Class: isomerase
Keywords: enolase, structural genomics, putative epimerase, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, ISOMERASE
Deposited on 2011-03-11, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia subsp. philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-362)
    Domains in SCOPe 2.07: d3r1za1, d3r1za2, d3r1za3, d3r1za4
  • Chain 'B':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia subsp. philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-364)
    Domains in SCOPe 2.07: d3r1zb1, d3r1zb2, d3r1zb3, d3r1zb4
  • Heterogens: ALA, GLU, SO4, GOL, DGL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r1zA (A:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r1zA (A:)
    vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
    qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
    akllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldn
    efsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnip
    vvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmes
    pagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenl
    yf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r1zB (B:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r1zB (B:)
    vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
    qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
    akllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldn
    efsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnip
    vvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmes
    pagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenl
    yfqs