PDB entry 3r18

View 3r18 on RCSB PDB site
Description: Chicken sulfite oxidase double mutant with altered activity and substrate affinity
Class: oxidoreductase
Keywords: molybdenum, molybdopterin, sulfite oxidase, nitrate reductase, oxotransferase, metal binding, nitrogen assimilation, oxidoreductase
Deposited on 2011-03-09, released 2012-02-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite oxidase
    Species: Gallus gallus [TaxId:9031]
    Gene: SULFITE OXIDASE, SUOX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07850 (Start-458)
      • see remark 999 (160)
      • see remark 999 (217)
      • see remark 999 (234-235)
      • see remark 999 (283)
      • see remark 999 (315)
      • engineered mutation (321)
      • engineered mutation (449)
      • see remark 999 (459-465)
    Domains in SCOPe 2.04: d3r18a1, d3r18a2
  • Heterogens: MTE, MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r18A (A:)
    apsypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwa
    lyavhgephvlellqqykvgelspdeapaapdaqdpfagdpprhpglrvnsqkpfnaepp
    aellaerfltpnelfftrnhlpvpavepssyrlrvdgpgggtlslslaelrsrfpkhevt
    atlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhagfpeelqgewhvcf
    egldadpggapygasipygralspaadvllayemngtelprdhgfpvrvvvpgvvgarsv
    kwlrrvavspdespshwqqndnkgfspcvdwdtvdyrtapaiqelpvqsavtqprpgaav
    ppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkappgrawawalweltvpve
    agteleivckavdssynvqpdsvapiwnlmgvlstawhrvrvsvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r18A (A:)
    qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
    rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar
    wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
    mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndnkgfspcvdwdt
    vdyrtapaiqelpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwk
    varlmgdkappgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlmgvl
    stawhrvrvsvqd