PDB entry 3r11

View 3r11 on RCSB PDB site
Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Mg and Fumarate complex
Class: isomerase
Keywords: enolase, structural genomics, putative epimerase, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, ISOMERASE
Deposited on 2011-03-09, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia subsp. philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-362)
    Domains in SCOPe 2.07: d3r11a1, d3r11a2, d3r11a3, d3r11a4
  • Chain 'B':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia subsp. philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-364)
    Domains in SCOPe 2.07: d3r11b1, d3r11b2, d3r11b3, d3r11b4
  • Heterogens: SO4, MG, GOL, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r11A (A:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r11A (A:)
    vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
    qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
    akllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldn
    efsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnip
    vvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmes
    pagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenl
    yf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r11B (B:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r11B (B:)
    vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
    qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
    akllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldn
    efsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnip
    vvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmes
    pagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenl
    yfqs