PDB entry 3r0m

View 3r0m on RCSB PDB site
Description: Crystal structure of anti-HIV llama VHH antibody A12
Class: Immune system
Keywords: Ig domain, Immune system
Deposited on 2011-03-08, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Llama VHH A12
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3R0M (0-End)
    Domains in SCOPe 2.07: d3r0ma_
  • Chain 'B':
    Compound: Llama VHH A12
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3R0M (0-End)
    Domains in SCOPe 2.07: d3r0mb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r0mA (A:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvsseqkliseedlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0mA (A:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r0mB (B:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvsseqkliseedlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0mB (B:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvss