PDB entry 3r0k

View 3r0k on RCSB PDB site
Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Tartrate bound, no Mg
Class: metal binding protein
Keywords: structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, METAL BINDING PROTEIN
Deposited on 2011-03-08, released 2011-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-362)
    Domains in SCOPe 2.05: d3r0ka1, d3r0ka2
  • Chain 'B':
    Compound: Enzyme of enolase superfamily
    Species: Francisella philomiragia [TaxId:484022]
    Gene: Fphi_1647
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0TZW0 (2-356)
      • expression tag (1)
      • expression tag (357-364)
    Domains in SCOPe 2.05: d3r0kb1, d3r0kb2
  • Heterogens: SO4, TAR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r0kA (A:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0kA (A:)
    vskiidiktsiikiplkrtfihidslaveltldngvkgygvapattaitgdtlqgmqyii
    reifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisvakllgak
    ansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefsknik
    frfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvadesv
    fdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagilat
    asfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenlyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r0kB (B:)
    mvskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdt
    lqgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdis
    vakllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkald
    nefsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsni
    pvvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmme
    spagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaen
    lyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0kB (B:)
    vskiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtl
    qgmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisv
    akllgakansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldn
    efsknikfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnip
    vvadesvfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmes
    pagilatasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnlaenl
    yfqs