PDB entry 3r06

View 3r06 on RCSB PDB site
Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment
Class: immune system
Keywords: antibody, anti-CD3epsilon, T-cell receptor, signalling, IMMUNE SYSTEM
Deposited on 2011-03-07, released 2012-01-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-212)
• Chain 'B':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-215)
• Chain 'C':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-212)
• Chain 'D':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-215)
• Chain 'E':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-212)
• Chain 'F':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-215)
• Chain 'H':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-215)
• Chain 'L':
  Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
  Species: Cricetulus migratorius [TaxId:10032]
  Database cross-references and differences (RAF-indexed):
  • PDB 3R06 (0-212)
  Domains in SCOPe 2.03: d3r06l1, d3r06l2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3r06L (L:)
  diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
  rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleikradakptvsifpp
  sseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstyslsstls
  ltkadyerhnlytcevthktstaaivktlnrne