PDB entry 3qz6

View 3qz6 on RCSB PDB site
Description: The crystal structure of HpcH/HpaI aldolase from Desulfitobacterium hafniense DCB-2
Class: lyase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, cytoplasmic, LYASE
Deposited on 2011-03-04, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HpcH/HpaI aldolase
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_2073
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8FRX2 (3-260)
      • expression tag (2)
    Domains in SCOPe 2.07: d3qz6a1, d3qz6a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qz6A (A:)
    snamflkkklsagksvvgtmlnlvynpdivriyaeagldyfivdcehaaytfreinhlvs
    vaknagvsvlvripqvdrahvqrlldigaegfmipgvqsaetmretvrlakypplgergv
    ggsivtdfkpvnwaewvqerndeifimaqiehvkavedidsilavqgvdavifgprdlsn
    dlgiigqtehpkvyecyekvyraadrqgvvkgfftaadaakmgwavergaqmllwsgdva
    alqtytakgvktikelpgfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz6A (A:)
    amflkkklsagksvvgtmlnlvynpdivriyaeagldyfivdcehaaytfreinhlvsva
    knagvsvlvripqvdrahvqrlldigaegfmipgvqsaetmretvrlakypplgergvgg
    sivtdfkpvnwaewvqerndeifimaqiehvkavedidsilavqgvdavifgprdlsndl
    giigqtehpkvyecyekvyraadrqgvvkgfftaadaakmgwavergaqmllwsgdvaal
    qtytakgvktikelpgfnp