PDB entry 3qwo

View 3qwo on RCSB PDB site
Description: Crystal structure of a motavizumab epitope-scaffold bound to motavizumab Fab
Class: Immune System
Keywords: Immune complex, Immune System
Deposited on 2011-02-28, released 2011-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: motavizumab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO (0-End)
  • Chain 'B':
    Compound: motavizumab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO (0-End)
    Domains in SCOPe 2.06: d3qwob1, d3qwob2
  • Chain 'C':
    Compound: motavizumab epitope scaffold
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO
    Domains in SCOPe 2.06: d3qwoc_
  • Chain 'H':
    Compound: motavizumab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO (0-End)
  • Chain 'L':
    Compound: motavizumab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO (0-End)
    Domains in SCOPe 2.06: d3qwol1, d3qwol2
  • Chain 'P':
    Compound: motavizumab epitope scaffold
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QWO (0-End)
    Domains in SCOPe 2.06: d3qwop_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qwoB (B:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwoB (B:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qwoC (C:)
    syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqadevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwoC (C:)
    syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqa
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qwoL (L:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwoL (L:)
    diqmtqspstlsasvgdrvtitcsassrvgymhwyqqkpgkapklliydtsklasgvpsr
    fsgsgsgteftltisslqpddfatyycfqgsgypftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3qwoP (P:)
    syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqadevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qwoP (P:)
    syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqa