PDB entry 3qw5

View 3qw5 on RCSB PDB site
Description: Crystal structure of the protease domain of Botulinum Neurotoxin Serotype A with a peptide inhibitor RRGF
Class: hydrolase/hydrolase inhibitor
Keywords: endopeptidase, syntaxin, bio-warfare agent, membrane, metal-binding, metalloprotease, protease, secreted, transmembrane, SNAP25, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-02-26, released 2012-02-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.213
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum [TaxId:441771]
    Gene: botA, CBO0806, CLC_0862
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qw5a_
  • Chain 'B':
    Compound: inhibitory peptide RRGF
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QW5 (0-End)
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qw5A (A:)
    mpfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdln
    pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
    stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
    gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
    rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
    ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
    lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknft
    glfehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qw5A (A:)
    mpfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdln
    pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
    stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
    gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
    rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
    ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
    lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknft
    glf
    

  • Chain 'B':
    No sequence available.