PDB entry 3qvn

View 3qvn on RCSB PDB site
Description: Crystal Structure of cytosolic MnSOD3 from Candida albicans
Class: oxidoreductase
Keywords: Mn Superoxide Dismutase, OXIDOREDUCTASE
Deposited on 2011-02-25, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Manganese-containing superoxide dismutase
    Species: Candida albicans [TaxId:5476]
    Gene: CaJ7.0018, SOD3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qvna1, d3qvna2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qvnA (A:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvkldyfkaiwnvinwaeaesrysa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvnA (A:)
    mitenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdl
    ksvveiqqnikfhggghtnhslfwknlapvskgggkhpdtssalgkqivaqygsvsnlid
    itnsklagiqgsgwafivknkqnggaldvvttanqdtisaphlvpiiaidawehayylqy
    qnvkldyfkaiwnvinwaeaesrys