PDB entry 3qvm

View 3qvm on RCSB PDB site
Description: The structure of olei00960, a hydrolase from Oleispira antarctica
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, alpha-beta hydrolase fold, hydrolase
Deposited on 2011-02-25, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Olei00960
    Species: Oleispira antarctica [TaxId:188908]
    Gene: Olei00960
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVM
    Domains in SCOPe 2.06: d3qvma_
  • Chain 'B':
    Compound: Olei00960
    Species: Oleispira antarctica [TaxId:188908]
    Gene: Olei00960
    Database cross-references and differences (RAF-indexed):
    • PDB 3QVM (0-End)
    Domains in SCOPe 2.06: d3qvmb_
  • Heterogens: SO4, NA, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qvmA (A:)
    gmikqdvicyekedvvkrnninitgggektvllahgfgcdqnmwrfmlpelekqftvivf
    dyvgsgqsdlesfstkrysslegyakdveeilvaldlvnvsiighsvssiiagiasthvg
    drisditmicpspcfmnfppdyvggferddleelinlmdknyigwanylaplvmgashss
    eligelsgsfcttdpivaktfakatffsdyrslledistpalifqsakdslaspevgqym
    aenipnsqleliqaeghclhmtdaglitpllihfiqnnqtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvmA (A:)
    dvicyekedvvkrnninitgggektvllahgfgcdqnmwrfmlpelekqftvivfdyvgs
    gqsdlesfstkrysslegyakdveeilvaldlvnvsiighsvssiiagiasthvgdrisd
    itmicpspcfmnfppdyvggferddleelinlmdknyigwanylaplvmgashsselige
    lsgsfcttdpivaktfakatffsdyrslledistpalifqsakdslaspevgqymaenip
    nsqleliqaeghclhmtdaglitpllihfiqnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qvmB (B:)
    gmikqdvicyekedvvkrnninitgggektvllahgfgcdqnmwrfmlpelekqftvivf
    dyvgsgqsdlesfstkrysslegyakdveeilvaldlvnvsiighsvssiiagiasthvg
    drisditmicpspcfmnfppdyvggferddleelinlmdknyigwanylaplvmgashss
    eligelsgsfcttdpivaktfakatffsdyrslledistpalifqsakdslaspevgqym
    aenipnsqleliqaeghclhmtdaglitpllihfiqnnqtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qvmB (B:)
    gmikqdvicyekedvvkrnninitgggektvllahgfgcdqnmwrfmlpelekqftvivf
    dyvgsgqsdlesfstkrysslegyakdveeilvaldlvnvsiighsvssiiagiasthvg
    drisditmicpspcfmnfppdyvggferddleelinlmdknyigwanylaplvmgashss
    eligelsgsfcttdpivaktfakatffsdyrslledistpalifqsakdslaspevgqym
    aenipnsqleliqaeghclhmtdaglitpllihfiqnnqt