PDB entry 3qu3

View 3qu3 on RCSB PDB site
Description: Crystal structure of IRF-7 DBD apo form
Class: DNA binding protein
Keywords: Helix-turn-helix, Gene regulation, DNA BINDING PROTEIN
Deposited on 2011-02-23, released 2011-06-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.169
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 7
    Species: Mus musculus [TaxId:10090]
    Gene: Irf7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qu3a_
  • Chain 'B':
    Compound: Interferon regulatory factor 7
    Species: Mus musculus [TaxId:10090]
    Gene: Irf7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qu3b_
  • Chain 'C':
    Compound: Interferon regulatory factor 7
    Species: Mus musculus [TaxId:10090]
    Gene: Irf7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qu3c_
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qu3A (A:)
    gshmaevrgvqrvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqi
    fkawavargrwppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvd
    phkvyelsrelgstvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu3A (A:)
    rvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargrw
    ppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyelsrel
    gs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qu3B (B:)
    gshmaevrgvqrvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqi
    fkawavargrwppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvd
    phkvyelsrelgstvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu3B (B:)
    rvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargrw
    ppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qu3C (C:)
    gshmaevrgvqrvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqi
    fkawavargrwppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvd
    phkvyelsrelgstvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qu3C (C:)
    qrvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargr
    wppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyels