PDB entry 3qtp

View 3qtp on RCSB PDB site
Description: Crystal Structure Analysis of Entamoeba histolytica Enolase
Class: lyase
Keywords: Glycolysis, Enolase, Lyase
Deposited on 2011-02-23, released 2011-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase 1
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: ENL-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51555 (5-440)
      • expression tag (3-4)
    Domains in SCOPe 2.06: d3qtpa1, d3qtpa2, d3qtpa3
  • Chain 'B':
    Compound: enolase 1
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: ENL-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51555 (5-440)
      • expression tag (2-4)
    Domains in SCOPe 2.06: d3qtpb1, d3qtpb2, d3qtpb3
  • Heterogens: 2PG, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qtpA (A:)
    gplgsmsiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkk
    ryggkgvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsms
    icraaaaekglplykylaeltghkemtmpvpcfnvinggahagnalamqefmicptgatn
    fhealrmaaetyqclkvvikakygqdatnvgdeggfapnvsgarealdllveaiakagyt
    gkieiamdcaasefyneetkkydlgkkipadkkdpslvkdvdgliaeyvdygkhypiasi
    edpfaeddwaawnkftvehgnfqivgddllvtnparvqmamdknacnsvlikvnqigtlt
    etfktikmaqekgwgvmashrsgetedtfiadlvvglnckqiktgapcrserlckynqlm
    rieeelgnipyagknwrnsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qtpA (A:)
    gsmsiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkkryg
    gkgvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsmsicr
    aaaaekglplykylaeltghkemtmpvpcfnvinggahagnalamqefmicptgatnfhe
    alrmaaetyqclkvvikakygqdatnvgdeggfapnvsgarealdllveaiakagytgki
    eiamdcaasefyneetkkydlgkkipadkkdpslvkdvdgliaeyvdygkhypiasiedp
    faeddwaawnkftvehgnfqivgddllvtnparvqmamdknacnsvlikvnqigtltetf
    ktikmaqekgwgvmashrsgetedtfiadlvvglnckqiktgapcrserlckynqlmrie
    eelgnipyagknwrnsta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qtpB (B:)
    gplgsmsiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkk
    ryggkgvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsms
    icraaaaekglplykylaeltghkemtmpvpcfnvinggahagnalamqefmicptgatn
    fhealrmaaetyqclkvvikakygqdatnvgdeggfapnvsgarealdllveaiakagyt
    gkieiamdcaasefyneetkkydlgkkipadkkdpslvkdvdgliaeyvdygkhypiasi
    edpfaeddwaawnkftvehgnfqivgddllvtnparvqmamdknacnsvlikvnqigtlt
    etfktikmaqekgwgvmashrsgetedtfiadlvvglnckqiktgapcrserlckynqlm
    rieeelgnipyagknwrnsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qtpB (B:)
    lgsmsiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkkry
    ggkgvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsmsic
    raaaaekglplykylaeltghkemtmpvpcfnvinggahagnalamqefmicptgatnfh
    ealrmaaetyqclkvvikakygqdatnvgdeggfapnvsgarealdllveaiakagytgk
    ieiamdcaasefyneetkkydlgkkipadkkdpslvkdvdgliaeyvdygkhypiasied
    pfaeddwaawnkftvehgnfqivgddllvtnparvqmamdknacnsvlikvnqigtltet
    fktikmaqekgwgvmashrsgetedtfiadlvvglnckqiktgapcrserlckynqlmri
    eeelgnipyagknwrnsta