PDB entry 3qsk

View 3qsk on RCSB PDB site
Description: 5 Histidine Variant of the anti-RNase A VHH in Complex with RNAse A
Class: hydrolase/immune system
Keywords: Antibody, Single Domain, Camelid, VHH, sdAb, RNase A, Ribonuclease A, pH, Sensitivity, Switch, Dependence, Linked, Equilibria, Equilibrium, Protein Engineering, Combinatorial, Histidine, Scanning, Phage Display, Dual-Function, Protein-Protein Interaction, Proton Binding, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2011-02-21, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qska_
  • Chain 'B':
    Compound: Engineered 5 Histidine anti-RNase A Camelid VHH Antibody Domain Variant
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3QSK (0-122)
    Domains in SCOPe 2.07: d3qskb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qskA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qskA (A:)
    ketaaakferqhmdssssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvac
    kngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qskB (B:)
    gsqvqlvesggglvqaggslrlscaasgyhhpyiymgwfrqapgkeregvaamdsggggt
    lyadsvkgrftisrdkgkntvylqmdslkpedtatyycaagghhlrdhtygqwgqgtqvt
    vss