PDB entry 3qrs

View 3qrs on RCSB PDB site
Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Aspartyl Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-02-18, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.214
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
  Domains in SCOPe 2.06: d3qrsa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
  Domains in SCOPe 2.06: d3qrsb_
• Heterogens: CL, NK8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrsA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qrsB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf