PDB entry 3qqu

View 3qqu on RCSB PDB site
Description: Cocrystal structure of unphosphorylated igf with pyrimidine 8
Class: transferase/transferase inhibitor
Keywords: igf, kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-02-16, released 2011-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.273
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qqua_
  • Chain 'B':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qqub_
  • Chain 'C':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qquc_
  • Chain 'D':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qqud_
  • Heterogens: 01P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qquA (A:)
    gsvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
    eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
    ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
    yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
    megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qquA (A:)
    ewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerieflne
    asvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrppslskmiqmageia
    dgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgllpvrwms
    peslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpdncpdm
    lfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qquB (B:)
    gsvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
    eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
    ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
    yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
    megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qquB (B:)
    vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
    lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpslskmiqmage
    iadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgllpvrw
    mspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpdncp
    dmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qquC (C:)
    gsvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
    eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
    ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
    yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
    megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qquC (C:)
    pdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreriefl
    neasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemvlappslskm
    iqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkg
    llpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglld
    kpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qquD (D:)
    gsvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreri
    eflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvla
    ppslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdy
    yrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfv
    megglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qquD (D:)
    pdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmreriefl
    neasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemlappslskmi
    qmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgl
    lpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldk
    pdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen