PDB entry 3qqd

View 3qqd on RCSB PDB site
Description: Human SOD1 H80R variant, P212121 crystal form
Class: oxidoreductase
Keywords: oxidoreductase, human cu, zn superoxide dismutase, antioxidant, metal-binding, amyotrophic lateral sclerosis, disease mutation, disulfide bond
Deposited on 2011-02-15, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.147
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-152)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d3qqda_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d3qqdb_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qqdA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerrvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqdA (A:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnprvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadgsrlacgvig
    iaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qqdB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerrvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qqdB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadnagsrla
    cgvigiaq