PDB entry 3qq9

View 3qq9 on RCSB PDB site
Description: Crystal structure of FAB fragment of anti-human RSV (RESPIRATORY SYNCYTIAL VIRUS) F Protein MAB 101F
Class: immune system
Keywords: immune system, RSV F protein
Deposited on 2011-02-15, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: 101f light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QQ9 (0-End)
    Domains in SCOPe 2.07: d3qq9c1, d3qq9c2
  • Chain 'D':
    Compound: 101f heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QQ9 (0-End)
  • Chain 'H':
    Compound: 101f heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QQ9 (0-End)
  • Chain 'L':
    Compound: 101f light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QQ9 (0-End)
    Domains in SCOPe 2.07: d3qq9l1, d3qq9l2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qq9C (C:)
    divltqspaslavslgqratifcrasqsvdyngisymhwfqqkpgqppklliyaasnpes
    giparftgsgsgtdftlnihpveeedaatyycqqiiedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qq9C (C:)
    divltqspaslavslgqratifcrasqsvdyngisymhwfqqkpgqppklliyaasnpes
    giparftgsgsgtdftlnihpveeedaatyycqqiiedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qq9L (L:)
    divltqspaslavslgqratifcrasqsvdyngisymhwfqqkpgqppklliyaasnpes
    giparftgsgsgtdftlnihpveeedaatyycqqiiedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qq9L (L:)
    divltqspaslavslgqratifcrasqsvdyngisymhwfqqkpgqppklliyaasnpes
    giparftgsgsgtdftlnihpveeedaatyycqqiiedpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge