PDB entry 3qom

View 3qom on RCSB PDB site
Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Glycoside hydrolase, hydrolase
Deposited on 2011-02-10, released 2011-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.118
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: pbg1, lp_0440
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88ZA9 (3-480)
      • expression tag (2)
    Domains in SCOPe 2.01: d3qoma_
  • Heterogens: BGC, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qomA (A:)
    snamtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvva
    gkyypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddl
    fdeclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmt
    fneinnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfq
    igcmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnldit
    aedlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglr
    yamnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdl
    igytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaei
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qomA (A:)
    amtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagk
    yypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfd
    eclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfn
    einnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqig
    cmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditae
    dlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglrya
    mnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdlig
    ytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie