PDB entry 3qn3

View 3qn3 on RCSB PDB site
Description: Phosphopyruvate hydratase from Campylobacter jejuni.
Class: lyase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, enolase, glycolysis, LYASE
Deposited on 2011-02-07, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj1672c, eno
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42448 (3-416)
      • expression tag (2)
    Domains in SCOPe 2.07: d3qn3a1, d3qn3a2, d3qn3a3
  • Chain 'B':
    Compound: enolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj1672c, eno
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42448 (3-416)
      • expression tag (2)
    Domains in SCOPe 2.07: d3qn3b1, d3qn3b2, d3qn3b3
  • Chain 'C':
    Compound: enolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj1672c, eno
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42448 (3-416)
      • expression tag (2)
    Domains in SCOPe 2.07: d3qn3c1, d3qn3c2, d3qn3c3
  • Chain 'D':
    Compound: enolase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj1672c, eno
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42448 (3-416)
      • expression tag (2)
    Domains in SCOPe 2.07: d3qn3d1, d3qn3d2, d3qn3d3
  • Heterogens: MG, MPD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qn3A (A:)
    snamlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnder
    fggkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmat
    araaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkea
    lrsvceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkia
    ldvasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwikltek
    lgnkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcv
    mshrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qn3A (A:)
    amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg
    gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar
    aaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkealr
    svceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkiald
    vasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwiklteklg
    nkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvms
    hrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qn3B (B:)
    snamlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnder
    fggkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmat
    araaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkea
    lrsvceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkia
    ldvasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwikltek
    lgnkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcv
    mshrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qn3B (B:)
    amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg
    gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar
    aaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkealr
    svceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkiald
    vasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwiklteklg
    nkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvms
    hrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qn3C (C:)
    snamlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnder
    fggkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmat
    araaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkea
    lrsvceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkia
    ldvasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwikltek
    lgnkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcv
    mshrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qn3C (C:)
    amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg
    gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar
    aaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkealr
    svceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkiald
    vasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwiklteklg
    nkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvms
    hrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qn3D (D:)
    snamlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnder
    fggkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmat
    araaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkea
    lrsvceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkia
    ldvasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwikltek
    lgnkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcv
    mshrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qn3D (D:)
    amlviedvrayevldsrgnptvkaevtlsdgsvgaaivpsgastgskealelrdnderfg
    gkgvlkavanvnetiadeilgldafnqtqlddtlreldgtnnysnlganatlgvsmatar
    aaaaalgmplyrylgganasilpvpmcniinggahannnvdfqefmimpfgftsfkealr
    svceiyailkkelansghstalgdeggfapnlanntepidllmtcikkagyenrvkiald
    vasteffkdgkyhmegkafssealieryvelcakypicsiedglaendfegwiklteklg
    nkiqlvgddlfvtnedilregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvms
    hrsgesedafiadfavalntgqiktgalargertakynrlleiefesdeylgekl