PDB entry 3qm2

View 3qm2 on RCSB PDB site
Description: 2.25 Angstrom Crystal Structure of Phosphoserine Aminotransferase (SerC) from Salmonella enterica subsp. enterica serovar Typhimurium
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2011-02-03, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: serC, STM0977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qm2a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: serC, STM0977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qm2b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qm2A (A:)
    mhhhhhhssgvdlgtenlyfqsnamaqvfnfssgpamlpaevlklaqqelcdwhglgtsv
    meishrgkefiqvaeeaeqdfrdllnipsnykvlfchgggrgqfagvplnllgdkttady
    vdagywaasaikeakkycapqiidakitvdgkravkpmrewqlsdnaaylhycpnetidg
    iaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpagltlvivredllg
    kahescpsildytvlndndsmfntpptfawylsglvfkwlkaqggvaamhkinqqkaell
    ygvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvvggmra
    siynampiegvkaltdfmidferrhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm2A (A:)
    qvfnfssgpamlpaevlklaqqevaeeaeqdfrdllnipsnykvlfchgggrgqfagvpl
    nllgdkttadyvdagywaasaikeakkycapqiidakitvdgkravkpmrewqlsdnaay
    lhycpnetidgiaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpagl
    tlvivredllgkahescpsildytvlndnptfawylsglvfkwlkaqggvaamhkinqqk
    aellygvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvvg
    gmrasiynampiegvkaltdfmidferrhg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qm2B (B:)
    mhhhhhhssgvdlgtenlyfqsnamaqvfnfssgpamlpaevlklaqqelcdwhglgtsv
    meishrgkefiqvaeeaeqdfrdllnipsnykvlfchgggrgqfagvplnllgdkttady
    vdagywaasaikeakkycapqiidakitvdgkravkpmrewqlsdnaaylhycpnetidg
    iaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpagltlvivredllg
    kahescpsildytvlndndsmfntpptfawylsglvfkwlkaqggvaamhkinqqkaell
    ygvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvvggmra
    siynampiegvkaltdfmidferrhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qm2B (B:)
    qvfnfssgpamlpaevlklaqqelvaeeaeqdfrdllnipsnykvlfchgggrgqfagvp
    lnllgdkttadyvdagywaasaikeakkycapqiidakitvdgkravkpmrewqlsdnaa
    ylhycpnetidgiaidetpdfgpevvvtadfsstilsapldvsrygviyagaqknigpag
    ltlvivredllgkahescpsildytvlndnptfawylsglvfkwlkaqggvaamhkinqq
    kaellygvidnsdfyrndvaqanrsrmnvpfqladntldkvfleesfaaglhalkghrvv
    ggmrasiynampiegvkaltdfmidferrhg