PDB entry 3qjz

View 3qjz on RCSB PDB site
Description: Crystal structure of PI3K-gamma in complex with benzothiazole 1
Class: transferase/transferase inhibitor
Keywords: p110, transferase, kinase, inhibitor, ATP-binding, p84, p101, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-01-31, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qjza1, d3qjza2, d3qjza3
  • Heterogens: QJZ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qjzA (A:)
    gseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjzA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihtsqtikvspddtpgailqsfvlrvcgrdeylvgetpiknfq
    wvrhclkngeeihvvldtppdpaldevrkedcdrkfrvkirgidipvtvfveaniqhgqq
    vlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycvqllyyvnlllidhrfl
    lrrgeyvlhmwqifnadkltsatnpdkensmsisilldempnqlrkqleaiiatdplnpl
    taedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvglt
    mqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllkrglr
    nkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlqkvtl
    dikslsdvssqvisqlkqklenlqnpesfrvpydpglkagalaiekckvmaskkkplwle
    fkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlcllpygcistgd
    kigmieivkdattiakiqqstgafkdevlnhwlkekspteekfqaaverfvyscagycva
    tfvlgigdrhndnimitetgnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqd
    icvkaylalrhhtnlliilfsmmlmtgmpskedieyirdaltvgkneedakkyfldqiev
    crdkgwtvqfnwflh