PDB entry 3qju

View 3qju on RCSB PDB site
Description: The structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: CYTOCHROME BA3 OXIDASE, Carbon monoxide, CO photodissociation, OXIDOREDUCTASE
Deposited on 2011-01-30, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.288
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qjua_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qjub1, d3qjub2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3qjuc_
  • Heterogens: CU1, HEM, HAS, CUA, CMO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qjuA (A:)
    mhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypl
    lkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmaf
    iglvvaalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaan
    pgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghp
    ivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptw
    kmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgll
    gfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpis
    daqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlag
    ivllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfava
    ailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjuA (A:)
    vyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqglt
    lhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneat
    vlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfw
    lmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiyti
    lpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpsl
    mtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasft
    ldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwfl
    gmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfs
    vllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlf
    ghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qjuB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjuB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qjuC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjuC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg