PDB entry 3qjh

View 3qjh on RCSB PDB site
Description: The crystal structure of the 5c.c7 TCR
Class: immune system
Keywords: Immunoglobulin domain, T cell receptor, IMMUNE SYSTEM
Deposited on 2011-01-28, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5c.c7 alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJH
    Domains in SCOPe 2.07: d3qjha1, d3qjha2
  • Chain 'B':
    Compound: 5c.c7 beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJH (0-242)
    Domains in SCOPe 2.07: d3qjhb1, d3qjhb2
  • Chain 'C':
    Compound: 5c.c7 alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJH
    Domains in SCOPe 2.07: d3qjhc1, d3qjhc2
  • Chain 'D':
    Compound: 5c.c7 beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJH (0-End)
    Domains in SCOPe 2.07: d3qjhd1, d3qjhd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qjhA (A:)
    mrgdqveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengr
    lksafdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjhA (A:)
    dqveqspsalslhegtgsalrcnftttmravqwfrknrgslinlfylasgtkengrlksa
    fdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpniqnpdpavyqlr
    dskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qjhB (B:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllviedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qjhC (C:)
    mrgdqveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengr
    lksafdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjhC (C:)
    dqveqspsalslhegtgsalrcnftttmravqwfrknrgslinlfylasgtkengrlksa
    fdskerystlhirdaqledsgtyfcaaeasntnkvvfgtgtrlqvlpniqnpdpavyqlr
    dskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qjhD (D:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllviedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qjhD (D:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllviedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    ra