PDB entry 3qj3

View 3qj3 on RCSB PDB site
Description: Structure of digestive procathepsin L2 proteinase from Tenebrio molitor larval midgut
Class: hydrolase
Keywords: hydrolase, proteinase, larval midgut
Deposited on 2011-01-28, released 2012-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L-like protein
    Species: Tenebrio molitor [TaxId:7067]
    Gene: pCAL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69G21 (Start-330)
      • engineered mutation (139)
    Domains in SCOPe 2.06: d3qj3a_
  • Chain 'B':
    Compound: Cathepsin L-like protein
    Species: Tenebrio molitor [TaxId:7067]
    Gene: pCAL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69G21 (Start-330)
      • engineered mutation (139)
    Domains in SCOPe 2.06: d3qj3b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qj3A (A:)
    mhhhhhhlegsalpstfvaekwenfkttyarsyvnakeetfrkqifqkkletfeehneky
    rqglvsytlgvnlftdmtpeemkaythglimpadlhkngipiktredlglnasvrypasf
    dwrdqgmvspvknqgscgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgc
    sggwmndaftyvaqnggidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmlad
    mvatkgpvavafdaddpfgsysggvyynptcetnkfthavlivgygnengqdywlvknsw
    gdgwgldgyfkiarnannhcgiagvasvptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qj3A (A:)
    lpstfvaekwenfkttyarsyvnakeetfrkqifqkkletfeehnekyrqglvsytlgvn
    lftdmtpeemkaythglimpadlhkngipiktredlglnasvrypasfdwrdqgmvspvk
    nqgscgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgcsggwmndaftyv
    aqnggidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmladmvatkgpvavaf
    daddpfgsysggvyynptcetnkfthavlivgygnengqdywlvknswgdgwgldgyfki
    arnannhcgiagvasvptl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qj3B (B:)
    mhhhhhhlegsalpstfvaekwenfkttyarsyvnakeetfrkqifqkkletfeehneky
    rqglvsytlgvnlftdmtpeemkaythglimpadlhkngipiktredlglnasvrypasf
    dwrdqgmvspvknqgscgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgc
    sggwmndaftyvaqnggidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmlad
    mvatkgpvavafdaddpfgsysggvyynptcetnkfthavlivgygnengqdywlvknsw
    gdgwgldgyfkiarnannhcgiagvasvptl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qj3B (B:)
    fvaekwenfkttyarsyvnakeetfrkqifqkkletfeehnekyrqglvsytlgvnlftd
    mtpeemkaythglimpadlhkngipiktredlglnasvrypasfdwrdqgmvspvknqgs
    cgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgcsggwmndaftyvaqng
    gidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmladmvatkgpvavafdadd
    pfgsysggvyynptcetnkfthavlivgygnengqdywlvknswgdgwgldgyfkiarna
    nnhcgiagvasvptl