PDB entry 3qhw

View 3qhw on RCSB PDB site
Description: Structure of a pCDK2/CyclinA transition-state mimic
Class: transferase/protein binding
Keywords: kinase catalytic domain, protein kinase, Cyclin, Phosphorylated Thr-160, Phosphorylated on Thr-160, TRANSFERASE-PROTEIN BINDING complex
Deposited on 2011-01-26, released 2011-05-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-297)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d3qhwa_
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Mus musculus [TaxId:10090]
    Gene: Ccna2, Ccna, Cyca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51943 (1-260)
      • expression tag (0)
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (2-297)
      • expression tag (0-1)
    Domains in SCOPe 2.01: d3qhwc_
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Mus musculus [TaxId:10090]
    Gene: Ccna2, Ccna, Cyca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51943 (1-260)
      • expression tag (0)
  • Chain 'J':
    Compound: CDK2 substrate peptide: PKTPKKAKKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHW (0-9)
  • Chain 'K':
    Compound: CDK2 substrate peptide: PKTPKKAKKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHW (0-9)
  • Chain 'L':
    Compound: CDK2 substrate peptide: PKTPKKAKKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHW (Start-9)
  • Chain 'M':
    Compound: CDK2 substrate peptide: PKTPKKAKKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QHW (Start-9)
  • Heterogens: ADP, MG, MGF, CL, DTU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qhwA (A:)
    ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
    nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
    hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
    yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
    sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qhwC (C:)
    ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
    nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
    hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
    yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
    sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.