PDB entry 3qgv

View 3qgv on RCSB PDB site
Description: Crystal structure of a thermostable amylase variant
Class: hydrolase
Keywords: (Beta/alpha)8-barrel, alpha-amylase, family 13 glycosyl, hydrolase
Deposited on 2011-01-25, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha amylase
    Species: Pyrococcus woesei [TaxId:2262]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QGV (0-434)
    Domains in SCOPe 2.07: d3qgva1, d3qgva2
  • Heterogens: ZN, CA, TRS, SO4, BCD, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qgvA (A:)
    akyselekggvimqafywdvpsggiwwdtirqkipewydagisaiwippaskgmggaysm
    gydpydffdlgeydqkgtvetrfgskqelvnmintahaygmkviadivinhraggdlewn
    pfvndytwtdfskvasgkytanyldfhpnelhagdsgtfggypdichdkswdqywlwasq
    esyaaylrsigidawrfdyvkgyapwvvkdwlnwwggwavgeywdtnvdavlnwayssga
    kvfdfalyykmdeafdnknipalvsalqngqtvvsrdpfkavtfvanhdtdiiwnkypay
    afiltyegqptifyrdyeewlnkdklknliwihenlaggstdivyydndelifvrngygd
    kpglityinlgsskagrwvyvpkfagaciheytgnlggwvdkyvyssgwvyleapaydpa
    ngqygysvwsycgvg