PDB entry 3qgu

View 3qgu on RCSB PDB site
Description: L,L-Diaminopimelate aminotransferase from Chalmydomonas reinhardtii
Class: transferase
Keywords: L-lysine, L,L-diaminopimelate aminotransferase, pyridoxal-5'-phosphate, Chamydomonas reinhardtii, TRANSFERASE
Deposited on 2011-01-25, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.126
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LL-diaminopimelate aminotransferase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: DPA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8IW39
      • conflict (406)
    Domains in SCOPe 2.07: d3qgua_
  • Chain 'B':
    Compound: LL-diaminopimelate aminotransferase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: DPA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8IW39
      • conflict (406)
    Domains in SCOPe 2.07: d3qgub_
  • Heterogens: SO4, GOL, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qguA (A:)
    mqlnvrstasgarsstrsrrmtavvqavaqragtidvqrnenfgklragylfpeiarrrk
    ahqeknpdakiislgigdtteplpkyiadamakaaaglatregysgygaeqgqgalreav
    astfyghagraadeifisdgskcdiariqmmfgskptvavqdpsypvyvdtsvmmgmtgd
    hngtgfdgieymvcnpdnhffpdlskakrtdiiffcspnnptgaaatraqltelvnfark
    ngsilvydaayalyisnpdcpktiyeipgadevaietcsfskyagftgvrlgwtvvpkal
    kyangepvhadwnrvmttcfngasnivqagglaclqpeglkemnamikfykenaqilktt
    ftemgfsvyggddapyiwvgfpgkpswdvfaeilercnivttpgsgygpagegfvrasaf
    gsrenileavrrfkeaygkrnashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qguA (A:)
    gtidvqrnenfgklragylfpeiarrrkahqeknpdakiislgigdtteplpkyiadama
    kaaaglatregysgygaeqgqgalreavastfyghagraadeifisdgskcdiariqmmf
    gskptvavqdpsypvyvdtsvmmgmtgdhngtgfdgieymvcnpdnhffpdlskakrtdi
    iffcspnnptgaaatraqltelvnfarkngsilvydaayalyisnpdcpktiyeipgade
    vaietcsfskyagftgvrlgwtvvpkalkyangepvhadwnrvmttcfngasnivqaggl
    aclqpeglkemnamikfykenaqilkttftemgfsvyggddapyiwvgfpgkpswdvfae
    ilercnivttpgsgygpagegfvrasafgsrenileavrrfkeayg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qguB (B:)
    mqlnvrstasgarsstrsrrmtavvqavaqragtidvqrnenfgklragylfpeiarrrk
    ahqeknpdakiislgigdtteplpkyiadamakaaaglatregysgygaeqgqgalreav
    astfyghagraadeifisdgskcdiariqmmfgskptvavqdpsypvyvdtsvmmgmtgd
    hngtgfdgieymvcnpdnhffpdlskakrtdiiffcspnnptgaaatraqltelvnfark
    ngsilvydaayalyisnpdcpktiyeipgadevaietcsfskyagftgvrlgwtvvpkal
    kyangepvhadwnrvmttcfngasnivqagglaclqpeglkemnamikfykenaqilktt
    ftemgfsvyggddapyiwvgfpgkpswdvfaeilercnivttpgsgygpagegfvrasaf
    gsrenileavrrfkeaygkrnashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qguB (B:)
    qavaqragtidvqrnenfgklragylfpeiarrrkahqeknpdakiislgigdtteplpk
    yiadamakaaaglatregysgygaeqgqgalreavastfyghagraadeifisdgskcdi
    ariqmmfgskptvavqdpsypvyvdtsvmmgmtgdhngtgfdgieymvcnpdnhffpdls
    kakrtdiiffcspnnptgaaatraqltelvnfarkngsilvydaayalyisnpdcpktiy
    eipgadevaietcsfskyagftgvrlgwtvvpkalkyangepvhadwnrvmttcfngasn
    ivqagglaclqpeglkemnamikfykenaqilkttftemgfsvyggddapyiwvgfpgkp
    swdvfaeilercnivttpgsgygpagegfvrasafgsrenileavrrfkeayg