PDB entry 3qg7

View 3qg7 on RCSB PDB site
Description: Structural Basis for Ligand Recognition and Discrimination of a Quorum Quenching Antibody
Class: immune system
Keywords: Immunoglobulin Fold, Antigen Recognition, AIP4, Secreted, IMMUNE SYSTEM
Deposited on 2011-01-24, released 2011-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: AP4-24H11 Antibody Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QG7 (0-212)
  • Chain 'L':
    Compound: AP4-24H11 Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QG7 (0-215)
    Domains in SCOPe 2.03: d3qg7l1, d3qg7l2
  • Heterogens: P6G, NA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qg7L (L:)
    dvvltqtplslpvslgdqasiscrssqrlvhsngniylhwflqkpgqspklliyklssrf
    sgvpdrfsgsgsgtdftlkisrvesedlgiyycsqtthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr