PDB entry 3qfs

View 3qfs on RCSB PDB site
Description: Crystal Structure of NADPH-Cytochrome P450 Reductase (FAD/NADPH domain)
Class: oxidoreductase
Keywords: NADPH-Cytochrome P450 Reductase, flavoprotein, FAD, NADPH, OXIDOREDUCTASE
Deposited on 2011-01-22, released 2011-08-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.211
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH--cytochrome P450 reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: POR, CYPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16435 (Start-457)
      • see remark 999 (280)
    Domains in SCOPe 2.03: d3qfsa1, d3qfsa2
  • Heterogens: FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qfsA (A:)
    mgsshhhhhhssglvprgshmsirqyelvvhtdidaakvymgemgrlksyenqkppfdak
    npflaavttnrklnqgterhlmhleldisdskiryesgdhvavypandsalvnqlgkilg
    adldvvmslnnldeesnkkhpfpcptsyrtaltyylditnpprtnvlyelaqyasepseq
    ellrkmasssgegkelylswvvearrhilailqdcpslrppidhlcellprlqaryysia
    ssskvhpnsvhicavvveyetkagrinkgvatnwlrakepvgenggralvpmfvrksqfr
    lpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyreel
    aqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmardv
    qntfydivaelgamehaqavdyikklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qfsA (A:)
    rqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmh
    leldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfp
    cptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvve
    arrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveyetka
    grinkgvatnwlrakepvgenggralvpmfvrksqfrlpfkattpvimvgpgtgvapfig
    fiqerawlrqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreqshk
    vyvqhllkqdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqavdyi
    kklmtkgrysldvws