PDB entry 3qfr

View 3qfr on RCSB PDB site
Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase (R457H Mutant)
Class: oxidoreductase
Keywords: NADPH-Cytochrome P450 Reductase, flavoprotein, Antley-Bixler syndrome, FAD, FMN, NADPH, OXIDOREDUCTASE
Deposited on 2011-01-22, released 2011-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH--cytochrome P450 reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: POR, CYPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16435 (Start-617)
      • engineered mutation (394)
    Domains in SCOPe 2.04: d3qfra1, d3qfra2, d3qfra3
  • Chain 'B':
    Compound: NADPH--cytochrome P450 reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: POR, CYPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16435 (Start-617)
      • engineered mutation (394)
    Domains in SCOPe 2.04: d3qfrb1, d3qfrb2, d3qfrb3
  • Heterogens: FAD, FMN, NAP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qfrA (A:)
    gshmvressfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydl
    adlsslpeidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktye
    hfnamgkyvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgee
    ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
    lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
    pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
    vvearrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveye
    tkagrinkgvatnwlrakepagenggralvpmfvrksqfrlpfkattpvimvgpgtgvap
    figfiqerawlrqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreq
    shkvyvqhllkqdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqav
    dyikklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qfrA (A:)
    ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
    eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
    yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgeessirqye
    lvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmhleld
    isdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfpcpts
    yrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvvearrh
    ilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveyetkagrin
    kgvatnwlrakepalvpmfvrksqfrlpfkattpvimvgpgtgvapfigfiqerawlrqq
    gkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreqshkvyvqhllkqdr
    ehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqavdyikklmtkgrysl
    dvws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qfrB (B:)
    gshmvressfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydl
    adlsslpeidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktye
    hfnamgkyvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgee
    ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
    lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
    pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
    vvearrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveye
    tkagrinkgvatnwlrakepagenggralvpmfvrksqfrlpfkattpvimvgpgtgvap
    figfiqerawlrqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreq
    shkvyvqhllkqdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqav
    dyikklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qfrB (B:)
    ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
    eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
    yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgssirqyelv
    vhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmhleldis
    dskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfpcptsyr
    taltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvvearrhil
    ailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveyetkagrinkg
    vatnwlrakepralvpmfvrksqfrlpfkattpvimvgpgtgvapfigfiqerawlrqqg
    kevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreqshkvyvqhllkqdre
    hlwklieggahiyvcgdarnmardvqntfydivaelgamehaqavdyikklmtkgrysld
    vws