PDB entry 3qfc

View 3qfc on RCSB PDB site
Description: Crystal Structure of Human NADPH-Cytochrome P450 (V492E mutant)
Class: oxidoreductase
Keywords: human CYPOR, cytochrome P450 reductase, flavoprotein, FAD, FMN, NADPH, OXIDOREDUCTASE
Deposited on 2011-01-21, released 2011-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH--cytochrome P450 reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: POR, CYPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16435 (Start-617)
      • see remark 999 (165)
      • engineered mutation (429)
      • see remark 999 (440)
    Domains in SCOPe 2.04: d3qfca1, d3qfca2, d3qfca3
  • Chain 'B':
    Compound: NADPH--cytochrome P450 reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: POR, CYPOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16435 (Start-617)
      • see remark 999 (165)
      • engineered mutation (429)
      • see remark 999 (440)
    Domains in SCOPe 2.04: d3qfcb1, d3qfcb2, d3qfcb3
  • Heterogens: FAD, FMN, NAP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qfcA (A:)
    gshmvressfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydl
    adlsslpeidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktye
    hfnamgkyvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatgee
    ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
    lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
    pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
    vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
    tkagrinkgeatnwlrakepvgenggralvpmfvrksqfrlpfkattpvimvgpgtgvap
    figfiqerawlrqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreq
    shkvyvqhllkqdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqav
    dyikklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qfcA (A:)
    essfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlssl
    peidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamg
    kyvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatgeessirqy
    elvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmhlel
    disdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfpcpt
    syrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvvearr
    hilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveyetkagri
    nkgeatnwlrakepvralvpmfvrksqfrlpfkattpvimvgpgtgvapfigfiqerawl
    rqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreqshkvyvqhllk
    qdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqavdyikklmtkgr
    ysldvws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qfcB (B:)
    gshmvressfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydl
    adlsslpeidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktye
    hfnamgkyvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatgee
    ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
    lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
    pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
    vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
    tkagrinkgeatnwlrakepvgenggralvpmfvrksqfrlpfkattpvimvgpgtgvap
    figfiqerawlrqqgkevgetllyygcrrsdedylyreelaqfhrdgaltqlnvafsreq
    shkvyvqhllkqdrehlwklieggahiyvcgdarnmardvqntfydivaelgamehaqav
    dyikklmtkgrysldvws
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qfcB (B:)
    ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
    eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
    yvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveatgeirqyelvv
    htdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmhleldisd
    skiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfpcptsyrt
    altyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvvearrhila
    ilqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveykgeatnwlrak
    epvralvpmfvrksqfrlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetll
    yygcrrsdedylyreelaqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieg
    gahiyvcgdarnmardvqntfydivaelgamehaqavdyikklmtkgrysldvws