PDB entry 3qf4

View 3qf4 on RCSB PDB site
Description: Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
Class: transport protein
Keywords: multidrug transporter, TRANSPORT PROTEIN
Deposited on 2011-01-21, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, ATP-binding protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0287
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYC3 (11-End)
      • expression tag (7-10)
  • Chain 'B':
    Compound: Uncharacterized ABC transporter ATP-binding protein TM_0288
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qf4b1, d3qf4b2
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qf4B (B:)
    mpeirrrphgpilekpalknptatlrrllgylrphtftlimvfvfvtvssilgvlspyli
    gktidvvfvprrfdllprymlilgtiyaltsllfwlqgkimltlsqdvvfrlrkelfekl
    qrvpvgffdrtphgdiisrvindvdninnvlgnsiiqffsgivtlagavimmfrvnvils
    lvtlsivpltvlitqivssqtrkyfyenqrvlgqlngiieedisgltviklftreekeme
    kfdrvneslrkvgtkaqifsgvlpplmnmvnnlgfalisgfggwlalkdiitvgtiatfi
    gysrqftrplnelsnqfnmiqmalasaerifeildleeekddpdavelrevrgeiefknv
    wfsydkkkpvlkditfhikpgqkvalvgptgsgkttivnllmrfydvdrgqilvdgidir
    kikrsslrssigivlqdtilfsttvkenlkygnpgatdeeikeaaklthsdhfikhlpeg
    yetvltdngedlsqgqrqllaitraflanpkilildeatsnvdtkteksiqaamwklmeg
    ktsiiiahrlntiknadliivlrdgeivemgkhdeliqkrgfyyelftsqyglvveke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qf4B (B:)
    gpilekpalknptatlrrllgylrphtftlimvfvfvtvssilgvlspyligktidvvfv
    prrfdllprymlilgtiyaltsllfwlqgkimltlsqdvvfrlrkelfeklqrvpvgffd
    rtphgdiisrvindvdninnvlgnsiiqffsgivtlagavimmfrvnvilslvtlsivpl
    tvlitqivssqtrkyfyenqrvlgqlngiieedisgltviklftreekemekfdrvnesl
    rkvgtkaqifsgvlpplmnmvnnlgfalisgfggwlalkdiitvgtiatfigysrqftrp
    lnelsnqfnmiqmalasaerifeildleeekddpdavelrevrgeiefknvwfsydkkkp
    vlkditfhikpgqkvalvgptgsgkttivnllmrfydvdrgqilvdgidirkikrsslrs
    sigivlqdtilfsttvkenlkygnpgatdeeikeaaklthsdhfikhlpegyetvltdng
    edlsqgqrqllaitraflanpkilildeatsnvdtkteksiqaamwklmegktsiiiahr
    lntiknadliivlrdgeivemgkhdeliqkrgfyyelftsqyglvvek